Back to rankings

TsingZ0/PFLlib

Pythonpfllib.com

Master Federated Learning in 2 Hoursβ€”Run It on Your PC!

non-iidfederated-learningpersonalizationpytorchpythondistributed-computingheterogeneitydifferential-privacyprivacyimagenetdomainnetiot
Star Growth
Stars
2.1k
Forks
412
Weekly Growth
β€”
Issues
5
1k2k
Apr 2021Jan 2023Oct 2024Jul 2026
ArtifactsPyPIpip install pfllib
README

icon PFLlib: Personalized Federated Learning Library and Benchmark

🎯We built a beginner-friendly federated learning (FL) library and benchmark: master FL in 2 hoursβ€”run it on your PC! Contribute your algorithms, datasets, and metrics to grow the FL community.

πŸ‘ The official website and leaderboard is live! Our methodsβ€”FedCP, GPFL, and FedDBEβ€”lead the way. Notably, FedDBE stands out with robust performance across varying data heterogeneity levels.

JMLR arXiv Apache License 2.0

Figure 1: An Example for FedAvg. You can create a scenario using generate_DATA.py and run an algorithm using main.py, clientNAME.py, and serverNAME.py. For a new algorithm, you only need to add new features in clientNAME.py and serverNAME.py.

🎯If you find our repository useful, please cite the corresponding paper:

@article{zhang2025pfllib,
  title={PFLlib: A Beginner-Friendly and Comprehensive Personalized Federated Learning Library and Benchmark},
  author={Zhang, Jianqing and Liu, Yang and Hua, Yang and Wang, Hao and Song, Tao and Xue, Zhengui and Ma, Ruhui and Cao, Jian},
  journal={Journal of Machine Learning Research},
  volume={26},
  number={50},
  pages={1--10},
  year={2025}
}

@inproceedings{Zhang2025htfllib,
  author={Zhang, Jianqing and Wu, Xinghao and Zhou, Yanbing and Sun, Xiaoting and Cai, Qiqi and Liu, Yang and Hua, Yang and Zheng, Zhenzhe and Cao, Jian and Yang, Qiang},
  title = {HtFLlib: A Comprehensive Heterogeneous Federated Learning Library and Benchmark},
  year = {2025},
  booktitle = {Proceedings of the 31st ACM SIGKDD Conference on Knowledge Discovery and Data Mining}
}

Key Features

  • 39 traditional FL (tFL) and personalized FL (pFL) algorithms, 3 scenarios, and 24 datasets.

  • Real-machine deployment: HtFL-OnDevice.

  • Some experimental results are avalible in its paper and here.

  • Refer to examples to learn how to use it.

  • Refer to easy to extend to learn how to add new data or algorithms.

  • The benchmark platform can simulate scenarios using the 4-layer CNN on Cifar100 for 500 clients on one NVIDIA GeForce RTX 3090 GPU card with only 5.08GB GPU memory cost.

  • We provide privacy evaluation and systematical research support.

  • You can now train on some clients and evaluate performance on new clients by setting args.num_new_clients in ./system/main.py. Please note that not all tFL/pFL algorithms support this feature.

  • PFLlib primarily focuses on data (statistical) heterogeneity. For algorithms and a benchmark platform that address both data and model heterogeneity, please refer to our extended project Heterogeneous Federated Learning (HtFLlib).

  • As we strive to meet diverse user demands, frequent updates to the project may alter default settings and scenario creation codes, affecting experimental results.

  • Closed issues may help you a lot when errors arise.

  • When submitting pull requests, please provide sufficient instructions and examples in the comment box.

The origin of the data heterogeneity phenomenon is the characteristics of users, who generate non-IID (not Independent and Identically Distributed) and unbalanced data. With data heterogeneity existing in the FL scenario, a myriad of approaches have been proposed to crack this hard nut. In contrast, the personalized FL (pFL) may take advantage of the statistically heterogeneous data to learn the personalized model for each user.

Algorithms with code (updating)

Traditional FL (tFL)

Basic tFL

Personalized FL (pFL)

Meta-learning-based pFL

Datasets and scenarios (updating)

We support 3 types of scenarios with various datasets and move the common dataset splitting code into ./dataset/utils for easy extension. If you need another data set, just write another code to download it and then use the utils.

label skew scenario

For the label skew scenario, we introduce 16 famous datasets:

  • MNIST
  • EMNIST
  • FEMNIST
  • Fashion-MNIST
  • Cifar10
  • Cifar100
  • AG News
  • Sogou News
  • Tiny-ImageNet
  • Country211
  • Flowers102
  • GTSRB
  • Shakespeare
  • Stanford Cars
  • COVIDx
  • kvasir

The datasets can be easily split into IID and non-IID versions. In the non-IID scenario, we distinguish between two types of distribution:

  1. Pathological non-IID: In this case, each client only holds a subset of the labels, for example, just 2 out of 10 labels from the MNIST dataset, even though the overall dataset contains all 10 labels. This leads to a highly skewed distribution of data across clients.

  2. Practical non-IID: Here, we model the data distribution using a Dirichlet distribution, which results in a more realistic and less extreme imbalance. For more details on this, refer to this paper.

Additionally, we offer a balance option, where data amount is evenly distributed across all clients.

feature shift scenario

For the feature shift scenario, we utilize 3 widely used datasets in Domain Adaptation:

  • Amazon Review (raw data can be fetched from this link)
  • Digit5 (raw data available here)
  • DomainNet

real-world scenario

For the real-world scenario, we introduce 5 naturally separated datasets:

  • Camelyon17 (5 hospitals, 2 labels)
  • iWildCam (194 camera traps, 158 labels)
  • Omniglot (20 clients, 50 labels)
  • HAR (Human Activity Recognition) (30 clients, 6 labels)
  • PAMAP2 (9 clients, 12 labels)

For more details on datasets and FL algorithms in IoT, please refer to FL-IoT.

Examples for MNIST in the label skew scenario

cd ./dataset
# Please modify train_ratio and alpha in dataset\utils\dataset_utils.py

python generate_MNIST.py iid - - # for iid and unbalanced scenario
python generate_MNIST.py iid balance - # for iid and balanced scenario
python generate_MNIST.py noniid - pat # for pathological noniid and unbalanced scenario
python generate_MNIST.py noniid - dir # for practical noniid and unbalanced scenario
python generate_MNIST.py noniid - exdir # for Extended Dirichlet strategy 

The command line output of running python generate_MNIST.py noniid - dir

Number of classes: 10
Client 0         Size of data: 2630      Labels:  [0 1 4 5 7 8 9]
                 Samples of labels:  [(0, 140), (1, 890), (4, 1), (5, 319), (7, 29), (8, 1067), (9, 184)]
--------------------------------------------------
Client 1         Size of data: 499       Labels:  [0 2 5 6 8 9]
                 Samples of labels:  [(0, 5), (2, 27), (5, 19), (6, 335), (8, 6), (9, 107)]
--------------------------------------------------
Client 2         Size of data: 1630      Labels:  [0 3 6 9]
                 Samples of labels:  [(0, 3), (3, 143), (6, 1461), (9, 23)]
--------------------------------------------------
Show more
Client 3         Size of data: 2541      Labels:  [0 4 7 8]
                 Samples of labels:  [(0, 155), (4, 1), (7, 2381), (8, 4)]
--------------------------------------------------
Client 4         Size of data: 1917      Labels:  [0 1 3 5 6 8 9]
                 Samples of labels:  [(0, 71), (1, 13), (3, 207), (5, 1129), (6, 6), (8, 40), (9, 451)]
--------------------------------------------------
Client 5         Size of data: 6189      Labels:  [1 3 4 8 9]
                 Samples of labels:  [(1, 38), (3, 1), (4, 39), (8, 25), (9, 6086)]
--------------------------------------------------
Client 6         Size of data: 1256      Labels:  [1 2 3 6 8 9]
                 Samples of labels:  [(1, 873), (2, 176), (3, 46), (6, 42), (8, 13), (9, 106)]
--------------------------------------------------
Client 7         Size of data: 1269      Labels:  [1 2 3 5 7 8]
                 Samples of labels:  [(1, 21), (2, 5), (3, 11), (5, 787), (7, 4), (8, 441)]
--------------------------------------------------
Client 8         Size of data: 3600      Labels:  [0 1]
                 Samples of labels:  [(0, 1), (1, 3599)]
--------------------------------------------------
Client 9         Size of data: 4006      Labels:  [0 1 2 4 6]
                 Samples of labels:  [(0, 633), (1, 1997), (2, 89), (4, 519), (6, 768)]
--------------------------------------------------
Client 10        Size of data: 3116      Labels:  [0 1 2 3 4 5]
                 Samples of labels:  [(0, 920), (1, 2), (2, 1450), (3, 513), (4, 134), (5, 97)]
--------------------------------------------------
Client 11        Size of data: 3772      Labels:  [2 3 5]
                 Samples of labels:  [(2, 159), (3, 3055), (5, 558)]
--------------------------------------------------
Client 12        Size of data: 3613      Labels:  [0 1 2 5]
                 Samples of labels:  [(0, 8), (1, 180), (2, 3277), (5, 148)]
--------------------------------------------------
Client 13        Size of data: 2134      Labels:  [1 2 4 5 7]
                 Samples of labels:  [(1, 237), (2, 343), (4, 6), (5, 453), (7, 1095)]
--------------------------------------------------
Client 14        Size of data: 5730      Labels:  [5 7]
                 Samples of labels:  [(5, 2719), (7, 3011)]
--------------------------------------------------
Client 15        Size of data: 5448      Labels:  [0 3 5 6 7 8]
                 Samples of labels:  [(0, 31), (3, 1785), (5, 16), (6, 4), (7, 756), (8, 2856)]
--------------------------------------------------
Client 16        Size of data: 3628      Labels:  [0]
                 Samples of labels:  [(0, 3628)]
--------------------------------------------------
Client 17        Size of data: 5653      Labels:  [1 2 3 4 5 7 8]
                 Samples of labels:  [(1, 26), (2, 1463), (3, 1379), (4, 335), (5, 60), (7, 17), (8, 2373)]
--------------------------------------------------
Client 18        Size of data: 5266      Labels:  [0 5 6]
                 Samples of labels:  [(0, 998), (5, 8), (6, 4260)]
--------------------------------------------------
Client 19        Size of data: 6103      Labels:  [0 1 2 3 4 9]
                 Samples of labels:  [(0, 310), (1, 1), (2, 1), (3, 1), (4, 5789), (9, 1)]
--------------------------------------------------
Total number of samples: 70000
The number of train samples: [1972, 374, 1222, 1905, 1437, 4641, 942, 951, 2700, 3004, 2337, 2829, 2709, 1600, 4297, 4086, 2721, 4239, 3949, 4577]
The number of test samples: [658, 125, 408, 636, 480, 1548, 314, 318, 900, 1002, 779, 943, 904, 534, 1433, 1362, 907, 1414, 1317, 1526]

Saving to disk.

Finish generating dataset.

Models

Environments

Install CUDA.

Install conda latest and activate conda.

For additional configurations, refer to the prepare.sh script.

conda env create -f env_cuda_latest.yaml  # Downgrade torch via pip if needed to match the CUDA version

How to start simulating (examples for FedAvg)

  • Download this project to an appropriate location using git.

    git clone https://github.com/TsingZ0/PFLlib.git
    
  • Create proper environments (see Environments).

  • Build evaluation scenarios (see Datasets and scenarios (updating)).

  • Run evaluation:

    cd ./system
    python main.py -data MNIST -m CNN -algo FedAvg -gr 2000 -did 0 # using the MNIST dataset, the FedAvg algorithm, and the 4-layer CNN model
    python main.py -data MNIST -m CNN -algo FedAvg -gr 2000 -did 0,1,2,3 # running on multiple GPUs
    

Note: It is preferable to tune algorithm-specific hyper-parameters before using any algorithm on a new machine.

Easy to extend

This library is designed to be easily extendable with new algorithms and datasets. Here’s how you can add them:

  • New Dataset: To add a new dataset, simply create a generate_DATA.py file in ./dataset and then write the download code and use the utils as shown in ./dataset/generate_MNIST.py (you can consider it as a template):

    # `generate_DATA.py`
    import necessary pkgs
    from utils import necessary processing funcs
    
    def generate_dataset(...):
      # download dataset as usual
      # pre-process dataset as usual
      X, y, statistic = separate_data((dataset_content, dataset_label), ...)
      train_data, test_data = split_data(X, y)
      save_file(config_path, train_path, test_path, train_data, test_data, statistic, ...)
    
    # call the generate_dataset func
    
  • New Algorithm: To add a new algorithm, extend the base classes Server and Client, which are defined in ./system/flcore/servers/serverbase.py and ./system/flcore/clients/clientbase.py, respectively.

    • Server
      # serverNAME.py
      import necessary pkgs
      from flcore.clients.clientNAME import clientNAME
      from flcore.servers.serverbase import Server
      
      class NAME(Server):
          def __init__(self, args, times):
              super().__init__(args, times)
      
              # select slow clients
              self.set_slow_clients()
              self.set_clients(clientAVG)
          def train(self):
              # server scheduling code of your algorithm
      
    • Client
      # clientNAME.py
      import necessary pkgs
      from flcore.clients.clientbase import Client
      
      class clientNAME(Client):
          def __init__(self, args, id, train_samples, test_samples, **kwargs):
              super().__init__(args, id, train_samples, test_samples, **kwargs)
              # add specific initialization
          
          def train(self):
              # client training code of your algorithm
      
  • New Model: To add a new model, simply include it in ./system/flcore/trainmodel/models.py.

  • New Optimizer: If you need a new optimizer for training, add it to ./system/flcore/optimizers/fedoptimizer.py.

  • New Benchmark Platform or Library: Our framework is flexible, allowing users to build custom platforms or libraries for specific applications, such as FL-IoT and HtFLlib.

Privacy Evaluation

You can use the following privacy evaluation methods to assess the privacy-preserving capabilities of tFL/pFL algorithms in PFLlib. Please refer to ./system/flcore/servers/serveravg.py for an example. Note that most of these evaluations are not typically considered in the original papers. We encourage you to add more attacks and metrics for privacy evaluation.

Currently supported attacks:

Currently supported metrics:

  • PSNR (Peak Signal-to-Noise Ratio): an objective metric for image evaluation, defined as the logarithm of the ratio of the squared maximum value of RGB image fluctuations to the Mean Squared Error (MSE) between two images. A lower PSNR score indicates better privacy-preserving capabilities.

Systematical research support

To simulate Federated Learning (FL) under practical conditions, such as client dropout, slow trainers, slow senders, and network TTL (Time-To-Live), you can adjust the following parameters:

  • -cdr: Dropout rate for clients. Clients are randomly dropped at each training round based on this rate.
  • -tsr and -ssr: Slow trainer and slow sender rates, respectively. These parameters define the proportion of clients that will behave as slow trainers or slow senders. Once a client is selected as a "slow trainer" or "slow sender," it will consistently train/send slower than other clients.
  • -tth: Threshold for network TTL in milliseconds.

Thanks to @Stonesjtu, this library can also record the GPU memory usage for the model.

Experimental Results

If you're interested in experimental results (e.g., accuracy) for the algorithms mentioned above, you can find results in our accepted FL papers, which also utilize this library. These papers include:

Please note that while these results were based on this library, reproducing the exact results may be challenging as some settings might have changed in response to community feedback. For example, in earlier versions, we set shuffle=False in clientbase.py.

Here are the relevant papers for your reference:

@inproceedings{zhang2023fedala,
  title={Fedala: Adaptive local aggregation for personalized federated learning},
  author={Zhang, Jianqing and Hua, Yang and Wang, Hao and Song, Tao and Xue, Zhengui and Ma, Ruhui and Guan, Haibing},
  booktitle={Proceedings of the AAAI Conference on Artificial Intelligence},
  volume={37},
  number={9},
  pages={11237--11244},
  year={2023}
}

@inproceedings{Zhang2023fedcp,
  author = {Zhang, Jianqing and Hua, Yang and Wang, Hao and Song, Tao and Xue, Zhengui and Ma, Ruhui and Guan, Haibing},
  title = {FedCP: Separating Feature Information for Personalized Federated Learning via Conditional Policy},
  year = {2023},
  booktitle = {Proceedings of the 29th ACM SIGKDD Conference on Knowledge Discovery and Data Mining}
}

@inproceedings{zhang2023gpfl,
  title={GPFL: Simultaneously Learning Global and Personalized Feature Information for Personalized Federated Learning},
  author={Zhang, Jianqing and Hua, Yang and Wang, Hao and Song, Tao and Xue, Zhengui and Ma, Ruhui and Cao, Jian and Guan, Haibing},
  booktitle={Proceedings of the IEEE/CVF International Conference on Computer Vision},
  pages={5041--5051},
  year={2023}
}

@inproceedings{zhang2023eliminating,
  title={Eliminating Domain Bias for Federated Learning in Representation Space},
  author={Jianqing Zhang and Yang Hua and Jian Cao and Hao Wang and Tao Song and Zhengui XUE and Ruhui Ma and Haibing Guan},
  booktitle={Thirty-seventh Conference on Neural Information Processing Systems},
  year={2023},
  url={https://openreview.net/forum?id=nO5i1XdUS0}
}